Products

IL-28B (Interleukin-28B), Human

Interleukin-28 (IL-28) is a cytokine that comes in two isoforms, IL-28A and IL-28B, and plays a role in immune defense against viruses, including the induction of an "antiviral state" by turning on Mx proteins, 2',5'-oligoadenylate synthetase as well as ISGF3G (Interferon Stimulated Gene Factor 3). IL-28A and IL-28B belong to the type III interferon family of cytokines and are highly similar (in amino acid sequence) to IL-29. Their classification as Interferons is due to their ability to induce an antiviral state, while their additional classification as cytokines is due to their chromosomal location as well as the fact that they are encoded by multiple exons, as opposed to a single exon, as most type-I IFNs are.
No. Size Price Qty Status
C01034-5UG 5 ug $108.00 Inquiry
C01034-20UG 20 ug $268.00 Inquiry
C01034-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDP
ALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
with polyhistidine tag at the C-terminus

UnitProt ID:
Q8IZI9
 
Source:
Escherichia coli

Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to protect HepG2 cells infected with encephalomyocarditis(EMC) virus. The ED50 for this effect is <5 ng/mL.
 
Purity:
>95% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for IL-28B (Interleukin-28B), Human

Average Rating: 0 (0 Reviews )